Lineage for d1wc6c_ (1wc6 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604796Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 604797Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam 00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 604798Protein Adenylate cyclase CyaC [117982] (1 species)
  7. 604799Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
  8. 604813Domain d1wc6c_: 1wc6 C: [114505]
    complexed with mg, tat

Details for d1wc6c_

PDB Entry: 1wc6 (more details), 2.51 Å

PDB Description: Soluble adenylyl cyclase CyaC from S. platensis in complex with Rp- ATPalphaS in presence of bicarbonate

SCOP Domain Sequences for d1wc6c_:

Sequence, based on SEQRES records: (download)

>d1wc6c_ d.58.29.1 (C:) Adenylate cyclase CyaC {Spirulina platensis}
lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg
mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel
kgidepvmtcvinpnml

Sequence, based on observed residues (ATOM records): (download)

>d1wc6c_ d.58.29.1 (C:) Adenylate cyclase CyaC {Spirulina platensis}
lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgvppvrfrcgihqgmav
vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
depvmtcvinpnml

SCOP Domain Coordinates for d1wc6c_:

Click to download the PDB-style file with coordinates for d1wc6c_.
(The format of our PDB-style files is described here.)

Timeline for d1wc6c_: