Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein Adenylate cyclase CyaC [117982] (1 species) |
Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries) Uniprot O32393 1004-1200 |
Domain d1wc5c1: 1wc5 C:1005-1199 [114501] Other proteins in same PDB: d1wc5a2, d1wc5b2, d1wc5c2 complexed with apc, ca, mg |
PDB Entry: 1wc5 (more details), 2.3 Å
SCOPe Domain Sequences for d1wc5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wc5c1 d.58.29.1 (C:1005-1199) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]} rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk gidepvmtcvinpnm
Timeline for d1wc5c1: