SCOPe 2.08: Domain d1wc5c1: 1wc5 C:1005-1199

Lineage for d1wc5c1 (1wc5 C:1005-1199)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
common fold is elaborated with additional secondary structures
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
Pfam PF00211
structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
Protein Adenylate cyclase CyaC [117982] (1 species)
Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
Uniprot O32393 1004-1200
Domain d1wc5c1: 1wc5 C:1005-1199 [114501]
Other proteins in same PDB: d1wc5a2, d1wc5b2, d1wc5c2
complexed with apc, ca, mg

Details for d1wc5c1

PDB Entry: 1wc5 (more details), 2.3 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp in presence of bicarbonate

PDB Compounds: (C:) adenylate cyclase

SCOPe Domain Sequences for d1wc5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc5c1 d.58.29.1 (C:1005-1199) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpnm

SCOPe Domain Coordinates for d1wc5c1:

Click to download the PDB-style file with coordinates for d1wc5c1.
(The format of our PDB-style files is described here.)

Timeline for d1wc5c1: