Lineage for d1wc4b1 (1wc4 B:1005-1201)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521614Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2521615Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2521616Protein Adenylate cyclase CyaC [117982] (1 species)
  7. 2521617Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
    Uniprot O32393 1004-1200
  8. 2521633Domain d1wc4b1: 1wc4 B:1005-1201 [114498]
    Other proteins in same PDB: d1wc4a2, d1wc4b2
    complexed with apc, eu3

Details for d1wc4b1

PDB Entry: 1wc4 (more details), 3 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp and europium
PDB Compounds: (B:) adenylate cyclase

SCOPe Domain Sequences for d1wc4b1:

Sequence, based on SEQRES records: (download)

>d1wc4b1 d.58.29.1 (B:1005-1201) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpnmln

Sequence, based on observed residues (ATOM records): (download)

>d1wc4b1 d.58.29.1 (B:1005-1201) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrvppvrfrcgihqgmav
vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
depvmtcvinpnmln

SCOPe Domain Coordinates for d1wc4b1:

Click to download the PDB-style file with coordinates for d1wc4b1.
(The format of our PDB-style files is described here.)

Timeline for d1wc4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wc4b2