Lineage for d1wc1a_ (1wc1 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863614Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 863615Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 863616Protein Adenylate cyclase CyaC [117982] (1 species)
  7. 863617Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
    Uniprot O32393 1004-1200
  8. 863618Domain d1wc1a_: 1wc1 A: [114492]

Details for d1wc1a_

PDB Entry: 1wc1 (more details), 1.93 Å

PDB Description: Soluble adenylyl cyclase CyaC from S. platensis in complex with Rp- ATPalphaS
PDB Compounds: (A:) adenylate cyclase

SCOP Domain Sequences for d1wc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc1a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg
mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel
kgidepvmtcvinpnml

SCOP Domain Coordinates for d1wc1a_:

Click to download the PDB-style file with coordinates for d1wc1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wc1a_: