| Root: SCOP 1.71 |
| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
| Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
| Species Archaeon Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries) |
| Domain d1wb8a2: 1wb8 A:93-208 [114483] Other proteins in same PDB: d1wb8a1, d1wb8b1 |
PDB Entry: 1wb8 (more details), 2.3 Å
SCOP Domain Sequences for d1wb8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl
Timeline for d1wb8a2: