SCOP 1.71: Domain d1wb8a2: 1wb8 A:93-208

Lineage for d1wb8a2 (1wb8 A:93-208)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries)

8. Domain d1wb8a2: 1wb8 A:93-208 [114483]
   Other proteins in same PDB: d1wb8a1, d1wb8b1

Details for d1wb8a2

PDB Entry: 1wb8, 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.

SCOP Domain Sequences for d1wb8a2:

Sequence; same for both SEQRES and ATOM records:

>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

Timeline for d1wb8a2:

• d1wb8a2 is new in SCOP 1.71
  
• d1wb8a2 appears in SCOP 1.73
  
• d1wb8a2 appears in the current release, SCOPe 2.08