Lineage for d1wb8a1 (1wb8 A:4-92)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 532116Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 532117Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 532145Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 532187Species Archaeon Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries)
  8. 532188Domain d1wb8a1: 1wb8 A:4-92 [114482]
    Other proteins in same PDB: d1wb8a2, d1wb8b2

Details for d1wb8a1

PDB Entry: 1wb8 (more details), 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.

SCOP Domain Sequences for d1wb8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus}
iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

SCOP Domain Coordinates for d1wb8a1:

Click to download the PDB-style file with coordinates for d1wb8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wb8a1:

Domains from same chain:
(mouse over for more information)
d1wb8a2
Domains from other chains:
(mouse over for more information)
d1wb8b1, d1wb8b2