Lineage for d1wb7b1 (1wb7 B:4-92)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256628Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1256656Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 1256750Species Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries)
    Uniprot P80857
  8. 1256754Domain d1wb7b1: 1wb7 B:4-92 [114480]
    Other proteins in same PDB: d1wb7a2, d1wb7b2
    complexed with fe; mutant

Details for d1wb7b1

PDB Entry: 1wb7 (more details), 2.24 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d1wb7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb7b1 a.2.11.1 (B:4-92) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]}
iqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

SCOPe Domain Coordinates for d1wb7b1:

Click to download the PDB-style file with coordinates for d1wb7b1.
(The format of our PDB-style files is described here.)

Timeline for d1wb7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wb7b2