SCOP 1.71: Domain d1wb7b1: 1wb7 B:4-92

Lineage for d1wb7b1 (1wb7 B:4-92)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries)

8. Domain d1wb7b1: 1wb7 B:4-92 [114480]
   Other proteins in same PDB: d1wb7a2, d1wb7b2
   complexed with fe; mutant

Details for d1wb7b1

PDB Entry: 1wb7, 2.24 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.

SCOP Domain Sequences for d1wb7b1:

Sequence; same for both SEQRES and ATOM records:

>d1wb7b1 a.2.11.1 (B:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus}
iqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

Timeline for d1wb7b1:

• d1wb7b1 is new in SCOP 1.71
  
• d1wb7b1 appears in SCOP 1.73
  
• d1wb7b1 appears in the current release, SCOPe 2.08