Lineage for d1wb7a2 (1wb7 A:93-208)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602270Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 602271Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 602272Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 602300Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 602342Species Archaeon Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries)
  8. 602345Domain d1wb7a2: 1wb7 A:93-208 [114479]
    Other proteins in same PDB: d1wb7a1, d1wb7b1

Details for d1wb7a2

PDB Entry: 1wb7 (more details), 2.24 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.

SCOP Domain Sequences for d1wb7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb7a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

SCOP Domain Coordinates for d1wb7a2:

Click to download the PDB-style file with coordinates for d1wb7a2.
(The format of our PDB-style files is described here.)

Timeline for d1wb7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wb7a1