SCOPe 2.02: Domain d1wb7a1: 1wb7 A:4-92

Lineage for d1wb7a1 (1wb7 A:4-92)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries)
   Uniprot P80857

8. Domain d1wb7a1: 1wb7 A:4-92 [114478]
   Other proteins in same PDB: d1wb7a2, d1wb7b2
   complexed with fe; mutant

Details for d1wb7a1

PDB Entry: 1wb7, 2.24 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d1wb7a1:

Sequence; same for both SEQRES and ATOM records:

>d1wb7a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]}
iqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

Timeline for d1wb7a1:

• d1wb7a1 first appeared in SCOP 1.71
  
• d1wb7a1 appears in SCOPe 2.01
  
• d1wb7a1 appears in SCOPe 2.03
  
• d1wb7a1 appears in the current release, SCOPe 2.08