Lineage for d1wb3a1 (1wb3 A:180-271)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952119Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 952120Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 952174Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 952175Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
    Uniprot Q8J307
  8. 952188Domain d1wb3a1: 1wb3 A:180-271 [114464]
    Other proteins in same PDB: d1wb3a3, d1wb3a4, d1wb3b2, d1wb3b3, d1wb3c3, d1wb3c4, d1wb3d2, d1wb3d3
    complexed with dxc, gnp, mg, so4

Details for d1wb3a1

PDB Entry: 1wb3 (more details), 3.2 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with the GTP analogue GppNHp
PDB Compounds: (A:) translation elongation factor selb

SCOPe Domain Sequences for d1wb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb3a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d1wb3a1:

Click to download the PDB-style file with coordinates for d1wb3a1.
(The format of our PDB-style files is described here.)

Timeline for d1wb3a1: