Class b: All beta proteins [48724] (149 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins) |
Protein Elongation factor SelB, domain 3 [117223] (1 species) |
Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries) |
Domain d1wb2c3: 1wb2 C:272-387 [114459] Other proteins in same PDB: d1wb2a1, d1wb2a2, d1wb2a4, d1wb2b1, d1wb2b3, d1wb2c1, d1wb2c2, d1wb2c4, d1wb2d1, d1wb2d3 |
PDB Entry: 1wb2 (more details), 3.1 Å
SCOP Domain Sequences for d1wb2c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb2c3 b.44.1.1 (C:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni
Timeline for d1wb2c3: