Lineage for d1wb2c3 (1wb2 C:272-387)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561274Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561275Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 561276Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins)
  6. 561288Protein Elongation factor SelB, domain 3 [117223] (1 species)
  7. 561289Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)
  8. 561296Domain d1wb2c3: 1wb2 C:272-387 [114459]
    Other proteins in same PDB: d1wb2a1, d1wb2a2, d1wb2a4, d1wb2b1, d1wb2b3, d1wb2c1, d1wb2c2, d1wb2c4, d1wb2d1, d1wb2d3

Details for d1wb2c3

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form

SCOP Domain Sequences for d1wb2c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb2c3 b.44.1.1 (C:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

SCOP Domain Coordinates for d1wb2c3:

Click to download the PDB-style file with coordinates for d1wb2c3.
(The format of our PDB-style files is described here.)

Timeline for d1wb2c3: