Lineage for d1wb2a1 (1wb2 A:180-271)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669500Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 669553Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 669554Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
  8. 669561Domain d1wb2a1: 1wb2 A:180-271 [114450]
    Other proteins in same PDB: d1wb2a3, d1wb2a4, d1wb2b2, d1wb2b3, d1wb2c3, d1wb2c4, d1wb2d2, d1wb2d3

Details for d1wb2a1

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form
PDB Compounds: (A:) translation elongation factor selb

SCOP Domain Sequences for d1wb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb2a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOP Domain Coordinates for d1wb2a1:

Click to download the PDB-style file with coordinates for d1wb2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wb2a1: