SCOP 1.71: Domain d1wb1b2: 1wb1 B:272-387

Lineage for d1wb1b2 (1wb1 B:272-387)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins)

6. Protein Elongation factor SelB, domain 3 [117223] (1 species)

7. Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)

8. Domain d1wb1b2: 1wb1 B:272-387 [114441]
   Other proteins in same PDB: d1wb1a1, d1wb1a2, d1wb1a4, d1wb1b1, d1wb1b3, d1wb1c1, d1wb1c2, d1wb1c4, d1wb1d1, d1wb1d3

Details for d1wb1b2

PDB Entry: 1wb1, 3 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with GDP

SCOP Domain Sequences for d1wb1b2:

Sequence; same for both SEQRES and ATOM records:

>d1wb1b2 b.44.1.1 (B:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

Timeline for d1wb1b2:

• d1wb1b2 is new in SCOP 1.71
  
• d1wb1b2 appears in SCOP 1.73
  
• d1wb1b2 last appears in SCOPe 2.01