SCOP 1.71: Domain d1waea1: 1wae A:2-159

Lineage for d1waea1 (1wae A:2-159)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (16 PDB entries)

8. Domain d1waea1: 1wae A:2-159 [114434]

Details for d1waea1

PDB Entry: 1wae, 1.95 Å

PDB Description: Crystal structure of H129V Mutant of Alcaligenes Xylosoxidans Nitrite Reductase

SCOP Domain Sequences for d1waea1:

Sequence; same for both SEQRES and ATOM records:

>d1waea1 b.6.1.3 (A:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyvcapegmvpwhvvsgmsgtlmvlprdglkdp

Timeline for d1waea1:

• d1waea1 is new in SCOP 1.71
  
• d1waea1 appears in SCOP 1.73
  
• d1waea1 appears in the current release, SCOPe 2.08