Lineage for d1wa5c_ (1wa5 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006372Protein Exportin Cse1p [116998] (1 species)
  7. 2006373Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116999] (2 PDB entries)
    Uniprot P33307
  8. 2006374Domain d1wa5c_: 1wa5 C: [114433]
    Other proteins in same PDB: d1wa5a_, d1wa5b_
    complexed with gtp, mg

Details for d1wa5c_

PDB Entry: 1wa5 (more details), 2 Å

PDB Description: crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
PDB Compounds: (C:) importin alpha re-exporter

SCOPe Domain Sequences for d1wa5c_:

Sequence, based on SEQRES records: (download)

>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalf
fknfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdr
wptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapfln
llktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyl
sysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsis
nqpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfedd
pieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwk
fkdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaik
yiytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiresntspafifhke
disnsteillknlialilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfi
eivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipy
vfqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlv
pvlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvk
kltvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvln
mvingqffqskyptlisstmnsiietassqsianlkndyvdldnleeistfgshfsklvs
isekpfdplpeidvnngvrlyvaealnkynaisgntflntilpqltqenqvklnqllvg

Sequence, based on observed residues (ATOM records): (download)

>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalf
fknfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdr
wptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapfln
llktvdeqitanekaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkylsy
snpllehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisnqpkydil
vskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddpieyirrd
legtrrractdflkelkeknevlvtniflahmkgfvdqymsnwkfkdlyiylftalaing
nitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaikyiytfrnqltkaqlie
lmpilatflqtdeyvvytyaaitiekiltiresntspafifhkedisnsteillknlial
ilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfieivtimaknpsnprft
hytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyvfqiiafvveqsatip
esikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvpvlgifqrliaskaye
vhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkkltvffglisnklgsd
flihfidevqdglfqqiwgnfiittlptignlldrkialigvlnmvingqffqskyptli
sstmnsiietassqsianlkndyveeistfgshfsklvsisekpfdplpeidvnngvrly
vaealnkynaisgntflntilpqltqenqvklnqllvg

SCOPe Domain Coordinates for d1wa5c_:

Click to download the PDB-style file with coordinates for d1wa5c_.
(The format of our PDB-style files is described here.)

Timeline for d1wa5c_: