Lineage for d1wa5b_ (1wa5 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1278586Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1278587Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
  6. 1278665Protein Karyopherin alpha [48383] (1 species)
  7. 1278666Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
    Uniprot Q02821 12-514
  8. 1278667Domain d1wa5b_: 1wa5 B: [114432]
    Other proteins in same PDB: d1wa5a_, d1wa5c_
    complexed with gtp, mg

Details for d1wa5b_

PDB Entry: 1wa5 (more details), 2 Å

PDB Description: crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
PDB Compounds: (B:) importin alpha subunit

SCOPe Domain Sequences for d1wa5b_:

Sequence, based on SEQRES records: (download)

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvpeyrrtnfknkgrfsadelrrrrdtqqvelrkakrdealakrrnfipptdgadsdeed
essvsadqqfysqlqqelpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagv
vprlvefmrenqpemlqleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevke
qaiwalgnvagdstdyrdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpd
wsvvsqalptlakliysmdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshe
stlvqtpalravgnivtgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitag
nteqiqavidanlipplvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcik
plcdlleiadnriievtldalenilkmgeadkearglninenadfiekaggmekifncqq
nendkiyekaykiietyfgeeed

Sequence, based on observed residues (ATOM records): (download)

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvpeyrrtelrrrrdtqqvelrkakrdealakrrnfqelpqmtqqlnsddmqeqlsatvk
frqilsrehrppidvviqagvvprlvefmrenqpemlqleaawaltniasgtsaqtkvvv
dadavplfiqllytgsvevkeqaiwalgnvagdstdyrdyvlqcnamepilglfnsnkps
lirtatwtlsnlcrgkkpqpdwsvvsqalptlakliysmdtetlvdacwaisylsdgpqe
aiqavidvripkrlvellshestlvqtpalravgnivtgndlqtqvvinagvlpalrlll
sspkenikkeacwtisnitagnteqiqavidanlipplvkllevaeyktkkeacwaisna
ssgglqrpdiirylvsqgcikplcdlleiadnriievtldalenilkmgeadkearglni
nenadfiekaggmekifncqqnendkiyekaykiietyfgeeed

SCOPe Domain Coordinates for d1wa5b_:

Click to download the PDB-style file with coordinates for d1wa5b_.
(The format of our PDB-style files is described here.)

Timeline for d1wa5b_: