Lineage for d1wa5b_ (1wa5 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542685Superfamily a.118.1: ARM repeat [48371] (17 families) (S)
  5. 542686Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
  6. 542742Protein Karyopherin alpha [48383] (1 species)
  7. 542743Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
  8. 542744Domain d1wa5b_: 1wa5 B: [114432]
    Other proteins in same PDB: d1wa5a_, d1wa5c_
    complexed with gtp, mg

Details for d1wa5b_

PDB Entry: 1wa5 (more details), 2 Å

PDB Description: structure of the cse1:imp-alpha:rangtp complex

SCOP Domain Sequences for d1wa5b_:

Sequence, based on SEQRES records: (download)

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae)}
fvpeyrrtnfknkgrfsadelrrrrdtqqvelrkakrdealakrrnfipptdgadsdeed
essvsadqqfysqlqqelpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagv
vprlvefmrenqpemlqleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevke
qaiwalgnvagdstdyrdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpd
wsvvsqalptlakliysmdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshe
stlvqtpalravgnivtgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitag
nteqiqavidanlipplvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcik
plcdlleiadnriievtldalenilkmgeadkearglninenadfiekaggmekifncqq
nendkiyekaykiietyfgeeed

Sequence, based on observed residues (ATOM records): (download)

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae)}
fvpeyrrtelrrrrdtqqvelrkakrdealakrrnfqelpqmtqqlnsddmqeqlsatvk
frqilsrehrppidvviqagvvprlvefmrenqpemlqleaawaltniasgtsaqtkvvv
dadavplfiqllytgsvevkeqaiwalgnvagdstdyrdyvlqcnamepilglfnsnkps
lirtatwtlsnlcrgkkpqpdwsvvsqalptlakliysmdtetlvdacwaisylsdgpqe
aiqavidvripkrlvellshestlvqtpalravgnivtgndlqtqvvinagvlpalrlll
sspkenikkeacwtisnitagnteqiqavidanlipplvkllevaeyktkkeacwaisna
ssgglqrpdiirylvsqgcikplcdlleiadnriievtldalenilkmgeadkearglni
nenadfiekaggmekifncqqnendkiyekaykiietyfgeeed

SCOP Domain Coordinates for d1wa5b_:

Click to download the PDB-style file with coordinates for d1wa5b_.
(The format of our PDB-style files is described here.)

Timeline for d1wa5b_: