SCOPe 2.06: Domain d1wa5a_: 1wa5 A:

Lineage for d1wa5a_ (1wa5 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
   Uniprot P62825

8. Domain d1wa5a_: 1wa5 A: [114431]
   Other proteins in same PDB: d1wa5b_, d1wa5c_
   complexed with gtp, mg

Details for d1wa5a_

PDB Entry: 1wa5, 2 Å

PDB Description: structure of the cse1:imp-alpha:rangtp complex

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d1wa5a_:

Sequence; same for both SEQRES and ATOM records:

>d1wa5a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef

Timeline for d1wa5a_:

• d1wa5a_ first appeared in SCOP 1.71
  
• d1wa5a_ appears in SCOPe 2.05
  
• d1wa5a_ appears in SCOPe 2.07
  
• d1wa5a_ appears in the current release, SCOPe 2.08