![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Ran [52609] (2 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [52610] (6 PDB entries) |
![]() | Domain d1wa5a_: 1wa5 A: [114431] Other proteins in same PDB: d1wa5b_, d1wa5c_ complexed with gtp, mg |
PDB Entry: 1wa5 (more details), 2 Å
SCOP Domain Sequences for d1wa5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa5a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)} pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef
Timeline for d1wa5a_: