SCOPe 2.08: Domain d1wa2x2: 1wa2 X:160-335

Lineage for d1wa2x2 (1wa2 X:160-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries)
   Uniprot O68601

8. Domain d1wa2x2: 1wa2 X:160-335 [114430]
   Other proteins in same PDB: d1wa2x1
   complexed with cu, mes, no2, so4, zn; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1wa2x2

PDB Entry: 1wa2, 1.72 Å

PDB Description: crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase with nitrite bound

PDB Compounds: (X:) dissimilatory copper-containing nitrite reductase,

SCOPe Domain Sequences for d1wa2x2:

Sequence; same for both SEQRES and ATOM records:

>d1wa2x2 b.6.1.3 (X:160-335) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaagqikvegkwnddlmkqikapapip

Timeline for d1wa2x2:

• d1wa2x2 first appeared in SCOP 1.71
  
• d1wa2x2 appears in SCOPe 2.07