Lineage for d1wa0x2 (1wa0 X:160-336)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) 
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) 
Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries)
Uniprot O68601
Domain d1wa0x2: 1wa0 X:160-336 [114426]
Other proteins in same PDB: d1wa0x1
complexed with cu, mes, pg4, so4, zn; mutant
has additional insertions and/or extensions that are not grouped together
Details for d1wa0x2
PDB Entry: 1wa0 (more details), 1.6 Å
PDB Description: crystal structure of w138h mutant of alcaligenes xylosoxidans nitrite reductase
PDB Compounds: (X:) dissimilatory copper-containing nitrite reductaseSCOPe Domain Sequences for d1wa0x2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa0x2 b.6.1.3 (X:160-336) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
SCOPe Domain Coordinates for d1wa0x2:
Click to download the PDB-style file with coordinates for d1wa0x2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wa0x2:
- d1wa0x2 first appeared in SCOP 1.71
- d1wa0x2 appears in SCOPe 2.07
View in 3D
