Lineage for d1wa0x1 (1wa0 X:2-159)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771876Species Alcaligenes xylosoxidans [TaxId:85698] [419328] (24 PDB entries)
    Uniprot O68601
  8. 2771891Domain d1wa0x1: 1wa0 X:2-159 [114425]
    Other proteins in same PDB: d1wa0x2
    complexed with cu, mes, pg4, so4, zn; mutant

Details for d1wa0x1

PDB Entry: 1wa0 (more details), 1.6 Å

PDB Description: crystal structure of w138h mutant of alcaligenes xylosoxidans nitrite reductase
PDB Compounds: (X:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d1wa0x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wa0x1 b.6.1.3 (X:2-159) Nitrite reductase, NIR, N-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvphhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d1wa0x1:

Click to download the PDB-style file with coordinates for d1wa0x1.
(The format of our PDB-style files is described here.)

Timeline for d1wa0x1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wa0x2