SCOP 1.71: Domain d1w9wa_: 1w9w A:

Lineage for d1w9wa_ (1w9w A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families)

5. Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)

6. Protein Hypothetical protein BH0236 [117106] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [117107] (3 PDB entries)

8. Domain d1w9wa_: 1w9w A: [114424]
   complexed with bgc, glc, na

Details for d1w9wa_

PDB Entry: 1w9w, 2.1 Å

PDB Description: structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans in complex with laminarihexaose

SCOP Domain Sequences for d1w9wa_:

Sequence; same for both SEQRES and ATOM records:

>d1w9wa_ b.18.1.10 (A:) Hypothetical protein BH0236 {Bacillus halodurans}
dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
eydlmnvnwfvfra

Timeline for d1w9wa_:

• d1w9wa_ is new in SCOP 1.71
  
• d1w9wa_ appears in SCOP 1.73
  
• d1w9wa_ appears in the current release, SCOPe 2.08