SCOP 1.71: Domain d1w9ub2: 1w9u B:299-360

Lineage for d1w9ub2 (1w9u B:299-360)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase 1 [54562] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117868] (2 PDB entries)

8. Domain d1w9ub2: 1w9u B:299-360 [114423]
   Other proteins in same PDB: d1w9ua1, d1w9ub1
   complexed with rig, so4

Details for d1w9ub2

PDB Entry: 1w9u, 1.85 Å

PDB Description: specificity and affnity of natural product cyclopentapeptide inhibitor argadin against aspergillus fumigatus chitinase

SCOP Domain Sequences for d1w9ub2:

Sequence; same for both SEQRES and ATOM records:

>d1w9ub2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

Timeline for d1w9ub2:

• d1w9ub2 is new in SCOP 1.71
  
• d1w9ub2 appears in SCOP 1.73
  
• d1w9ub2 appears in the current release, SCOPe 2.08