SCOPe 2.02: Domain d1w9tb_: 1w9t B:

Lineage for d1w9tb_ (1w9t B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)

6. Protein Hypothetical protein BH0236 [117106] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [117107] (3 PDB entries)
   Uniprot Q9KG76 790-923

8. Domain d1w9tb_: 1w9t B: [114419]
   complexed with na, xyp, xys

Details for d1w9tb_

PDB Entry: 1w9t, 1.62 Å

PDB Description: structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans in complex with xylobiose

PDB Compounds: (B:) bh0236 protein

SCOPe Domain Sequences for d1w9tb_:

Sequence; same for both SEQRES and ATOM records:

>d1w9tb_ b.18.1.10 (B:) Hypothetical protein BH0236 {Bacillus halodurans [TaxId: 86665]}
dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
eydlmnvnwfvfra

Timeline for d1w9tb_:

• d1w9tb_ first appeared in SCOP 1.71
  
• d1w9tb_ appears in SCOPe 2.01
  
• d1w9tb_ appears in SCOPe 2.03
  
• d1w9tb_ appears in the current release, SCOPe 2.08