Lineage for d1w9sa_ (1w9s A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942407Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 942425Protein Hypothetical protein BH0236 [117106] (1 species)
  7. 942426Species Bacillus halodurans [TaxId:86665] [117107] (3 PDB entries)
    Uniprot Q9KG76 790-923
  8. 942427Domain d1w9sa_: 1w9s A: [114416]
    complexed with gol, na

Details for d1w9sa_

PDB Entry: 1w9s (more details), 1.59 Å

PDB Description: structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans
PDB Compounds: (A:) bh0236 protein

SCOPe Domain Sequences for d1w9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9sa_ b.18.1.10 (A:) Hypothetical protein BH0236 {Bacillus halodurans [TaxId: 86665]}
dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
eydlmnvnwfvfra

SCOPe Domain Coordinates for d1w9sa_:

Click to download the PDB-style file with coordinates for d1w9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1w9sa_: