SCOPe 2.08: Domain d1w9pb2: 1w9p B:299-360

Lineage for d1w9pb2 (1w9p B:299-360)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase 1 [54562] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries)
   Uniprot Q873X9

8. Domain d1w9pb2: 1w9p B:299-360 [114415]
   Other proteins in same PDB: d1w9pa1, d1w9pb1
   complexed with so4

Details for d1w9pb2

PDB Entry: 1w9p, 1.7 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitors against aspergillus fumigatus, human and bacterial chitinasefra

PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d1w9pb2:

Sequence; same for both SEQRES and ATOM records:

>d1w9pb2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

Timeline for d1w9pb2:

• d1w9pb2 first appeared in SCOP 1.71
  
• d1w9pb2 appears in SCOPe 2.07