Lineage for d1w9pb1 (1w9p B:39-298,B:361-433)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146554Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1146555Protein Chitinase 1 [51548] (2 species)
  7. 1146556Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
    Uniprot Q873X9
  8. 1146558Domain d1w9pb1: 1w9p B:39-298,B:361-433 [114414]
    Other proteins in same PDB: d1w9pa2, d1w9pb2
    complexed with so4

Details for d1w9pb1

PDB Entry: 1w9p (more details), 1.7 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitors against aspergillus fumigatus, human and bacterial chitinasefra
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d1w9pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9pb1 c.1.8.5 (B:39-298,B:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt

SCOPe Domain Coordinates for d1w9pb1:

Click to download the PDB-style file with coordinates for d1w9pb1.
(The format of our PDB-style files is described here.)

Timeline for d1w9pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9pb2