Lineage for d1w9cb_ (1w9c B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 647064Family a.118.1.19: Exportin HEAT-like repeat [117002] (1 protein)
    this is a repeat family; one repeat unit is 3gb8 A:533-577 found in domain
  6. 647065Protein Exportin-1 (Xpo1, Crm1) [117003] (1 species)
  7. 647066Species Human (Homo sapiens) [TaxId:9606] [117004] (1 PDB entry)
  8. 647068Domain d1w9cb_: 1w9c B: [114411]
    proteolytic fragment spanning six C-terminal HEAT repeats

Details for d1w9cb_

PDB Entry: 1w9c (more details), 2.3 Å

PDB Description: proteolytic fragment of crm1 spanning six c-terminal heat repeats
PDB Compounds: (B:) crm1 protein

SCOP Domain Sequences for d1w9cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9cb_ a.118.1.19 (B:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]}
viqlgriyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrs
ndpqmvaenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdav
fectlnminkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafkhtm
rnvadtglqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasil
aymfnlveegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfslnq
dipafkehlrdflvqikefag

SCOP Domain Coordinates for d1w9cb_:

Click to download the PDB-style file with coordinates for d1w9cb_.
(The format of our PDB-style files is described here.)

Timeline for d1w9cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w9ca_