![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.19: Exportin HEAT-like repeat [117002] (2 proteins) Pfam PF08389, Pfam PF08767; full length proteins have several extra helices at C-terminus this is a repeat family; one repeat unit is 3gb8 A:533-577 found in domain |
![]() | Protein Exportin-1 (Xpo1, Crm1) [117003] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117004] (2 PDB entries) Uniprot O14980 707-1027 |
![]() | Domain d1w9cb_: 1w9c B: [114411] proteolytic fragment spanning six C-terminal HEAT repeats |
PDB Entry: 1w9c (more details), 2.3 Å
SCOPe Domain Sequences for d1w9cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9cb_ a.118.1.19 (B:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]} viqlgriyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrs ndpqmvaenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdav fectlnminkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafkhtm rnvadtglqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasil aymfnlveegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfslnq dipafkehlrdflvqikefag
Timeline for d1w9cb_: