SCOPe 2.08: Domain d1w9ca_: 1w9c A:

Lineage for d1w9ca_ (1w9c A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.19: Exportin HEAT-like repeat [117002] (2 proteins)
   Pfam PF08389, Pfam PF08767; full length proteins have several extra helices at C-terminus
   this is a repeat family; one repeat unit is 3gb8 A:533-577 found in domain

6. Protein Exportin-1 (Xpo1, Crm1) [117003] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117004] (2 PDB entries)
   Uniprot O14980 707-1027

8. Domain d1w9ca_: 1w9c A: [114410]
   proteolytic fragment spanning six C-terminal HEAT repeats

Details for d1w9ca_

PDB Entry: 1w9c, 2.3 Å

PDB Description: proteolytic fragment of crm1 spanning six c-terminal heat repeats

PDB Compounds: (A:) crm1 protein

SCOPe Domain Sequences for d1w9ca_:

Sequence; same for both SEQRES and ATOM records:

>d1w9ca_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]}
viqlgriyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrs
ndpqmvaenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdav
fectlnminkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafkhtm
rnvadtglqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasil
aymfnlveegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfslnq
dipafkehlrdflvqikefag

Timeline for d1w9ca_:

• d1w9ca_ first appeared in SCOP 1.71
  
• d1w9ca_ appears in SCOPe 2.07