Lineage for d1w9ab_ (1w9a B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561372Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 561373Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 561374Family b.45.1.1: PNP-oxidase like [50476] (6 proteins)
  6. 561383Protein Hypothetical protein Rv1155 [117230] (1 species)
  7. 561384Species Mycobacterium tuberculosis [TaxId:1773] [117231] (2 PDB entries)
  8. 561386Domain d1w9ab_: 1w9a B: [114409]
    Structural genomics target

Details for d1w9ab_

PDB Entry: 1w9a (more details), 1.8 Å

PDB Description: Crystal structure of Rv1155 from Mycobacterium tuberculosis

SCOP Domain Sequences for d1w9ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9ab_ b.45.1.1 (B:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

SCOP Domain Coordinates for d1w9ab_:

Click to download the PDB-style file with coordinates for d1w9ab_.
(The format of our PDB-style files is described here.)

Timeline for d1w9ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w9aa_