Lineage for d1w9aa_ (1w9a A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 670037Protein Hypothetical protein Rv1155 [117230] (1 species)
  7. 670038Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
  8. 670039Domain d1w9aa_: 1w9a A: [114408]

Details for d1w9aa_

PDB Entry: 1w9a (more details), 1.8 Å

PDB Description: Crystal structure of Rv1155 from Mycobacterium tuberculosis
PDB Compounds: (A:) hypothetical protein Rv1155

SCOP Domain Sequences for d1w9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9aa_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
fddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdp
rasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamv
tdrrvlltlpishvyglppgmr

SCOP Domain Coordinates for d1w9aa_:

Click to download the PDB-style file with coordinates for d1w9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1w9aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w9ab_