SCOPe 2.08: Domain d1w97l2: 1w97 L:146-239

Lineage for d1w97l2 (1w97 L:146-239)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.11: Cyto-EpsL domain [117644] (2 proteins)
   N-terminal part of Pfam PF05134
6. Protein Cytoplasmic domain of general secretion pathway protein L, EpsL [117645] (1 species)
7. Species Vibrio cholerae [TaxId:666] [117646] (2 PDB entries)
   Uniprot P45782 6-244

8. Domain d1w97l2: 1w97 L:146-239 [114407]

Details for d1w97l2

PDB Entry: 1w97, 2.7 Å

PDB Description: cyto-epsl: the cytoplasmic domain of epsl, an inner membrane component of the type ii secretion system of vibrio cholerae

PDB Compounds: (L:) type II secretion system protein l

SCOPe Domain Sequences for d1w97l2:

Sequence; same for both SEQRES and ATOM records:

>d1w97l2 c.55.1.11 (L:146-239) Cytoplasmic domain of general secretion pathway protein L, EpsL {Vibrio cholerae [TaxId: 666]}
ehglaalqlgdewlvrksttqgmavdaqwlsllaasdwvqnegeylplqaltplpelsla
etqewryepsglvmqlltqealtskfnlltgsfk

Timeline for d1w97l2:

• d1w97l2 first appeared in SCOP 1.71
  
• d1w97l2 appears in SCOPe 2.07