Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries) |
Domain d1w96c2: 1w96 C:14-183 [114404] Other proteins in same PDB: d1w96a1, d1w96a3, d1w96b1, d1w96b3, d1w96c1, d1w96c3 complexed with s1a |
PDB Entry: 1w96 (more details), 1.8 Å
SCOP Domain Sequences for d1w96c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w96c2 c.30.1.1 (C:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl
Timeline for d1w96c2: