Class b: All beta proteins [48724] (174 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) |
Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
Protein Acetyl-CoA carboxylase, BC-C subdomain [117328] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117329] (2 PDB entries) Uniprot Q00955 13-566 |
Domain d1w96c1: 1w96 C:451-549 [114403] Other proteins in same PDB: d1w96a2, d1w96a3, d1w96b2, d1w96b3, d1w96c2, d1w96c3 complexed with s1a |
PDB Entry: 1w96 (more details), 1.8 Å
SCOP Domain Sequences for d1w96c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w96c1 b.84.2.1 (C:451-549) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvgnngnihsfsdsqfghif afgenrqasrkhmvvalkelsirgdfrttveylikllet
Timeline for d1w96c1: