Lineage for d1w96c1 (1w96 C:451-549)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678222Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 678273Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 678274Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 678275Protein Acetyl-CoA carboxylase, BC-C subdomain [117328] (1 species)
  7. 678276Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117329] (2 PDB entries)
  8. 678279Domain d1w96c1: 1w96 C:451-549 [114403]
    Other proteins in same PDB: d1w96a2, d1w96a3, d1w96b2, d1w96b3, d1w96c2, d1w96c3
    complexed with s1a

Details for d1w96c1

PDB Entry: 1w96 (more details), 1.8 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae in complex with soraphen a
PDB Compounds: (C:) acetyl-coenzyme a carboxylase

SCOP Domain Sequences for d1w96c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w96c1 b.84.2.1 (C:451-549) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvgnngnihsfsdsqfghif
afgenrqasrkhmvvalkelsirgdfrttveylikllet

SCOP Domain Coordinates for d1w96c1:

Click to download the PDB-style file with coordinates for d1w96c1.
(The format of our PDB-style files is described here.)

Timeline for d1w96c1: