Lineage for d1w96b3 (1w96 B:184-450)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 873885Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 873905Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 873906Protein Acetyl-CoA carboxylase, BC-M subdomain [118120] (1 species)
  7. 873907Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118121] (2 PDB entries)
    Uniprot Q00955 13-566
  8. 873909Domain d1w96b3: 1w96 B:184-450 [114402]
    Other proteins in same PDB: d1w96a1, d1w96a2, d1w96b1, d1w96b2, d1w96c1, d1w96c2

Details for d1w96b3

PDB Entry: 1w96 (more details), 1.8 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae in complex with soraphen a
PDB Compounds: (B:) acetyl-coenzyme a carboxylase

SCOP Domain Sequences for d1w96b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w96b3 d.142.1.2 (B:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gdkisstivaqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkak
rigfpvmikaseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevql
ladqygtnislfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagt
veylyshddgkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlyg
mnphsaseidfefktqdatkkqrrpip

SCOP Domain Coordinates for d1w96b3:

Click to download the PDB-style file with coordinates for d1w96b3.
(The format of our PDB-style files is described here.)

Timeline for d1w96b3: