Lineage for d1w96b2 (1w96 B:14-183)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694027Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 694028Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 694029Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 694030Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species)
  7. 694031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries)
  8. 694033Domain d1w96b2: 1w96 B:14-183 [114401]
    Other proteins in same PDB: d1w96a1, d1w96a3, d1w96b1, d1w96b3, d1w96c1, d1w96c3

Details for d1w96b2

PDB Entry: 1w96 (more details), 1.8 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae in complex with soraphen a
PDB Compounds: (B:) acetyl-coenzyme a carboxylase

SCOP Domain Sequences for d1w96b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w96b2 c.30.1.1 (B:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl

SCOP Domain Coordinates for d1w96b2:

Click to download the PDB-style file with coordinates for d1w96b2.
(The format of our PDB-style files is described here.)

Timeline for d1w96b2: