![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries) |
![]() | Domain d1w96b2: 1w96 B:14-183 [114401] Other proteins in same PDB: d1w96a1, d1w96a3, d1w96b1, d1w96b3, d1w96c1, d1w96c3 |
PDB Entry: 1w96 (more details), 1.8 Å
SCOP Domain Sequences for d1w96b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w96b2 c.30.1.1 (B:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae)} meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl
Timeline for d1w96b2: