SCOP 1.75: Domain d1w93a3: 1w93 A:184-450

Lineage for d1w93a3 (1w93 A:184-450)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)

6. Protein Acetyl-CoA carboxylase, BC-M subdomain [118120] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118121] (2 PDB entries)
   Uniprot Q00955 13-566

8. Domain d1w93a3: 1w93 A:184-450 [114396]
   Other proteins in same PDB: d1w93a1, d1w93a2

Details for d1w93a3

PDB Entry: 1w93, 2.5 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae

PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOP Domain Sequences for d1w93a3:

Sequence; same for both SEQRES and ATOM records:

>d1w93a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gdkisstivaqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkak
rigfpvmikaseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevql
ladqygtnislfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagt
veylyshddgkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlyg
mnphsaseidfefktqdatkkqrrpip

Timeline for d1w93a3:

• d1w93a3 first appeared in SCOP 1.71
  
• d1w93a3 appears in SCOP 1.73
  
• d1w93a3 appears in SCOPe 2.01
  
• d1w93a3 appears in the current release, SCOPe 2.08