![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) ![]() |
![]() | Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins) |
![]() | Protein Acetyl-CoA carboxylase, BC-M subdomain [118120] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118121] (2 PDB entries) |
![]() | Domain d1w93a3: 1w93 A:184-450 [114396] Other proteins in same PDB: d1w93a1, d1w93a2 |
PDB Entry: 1w93 (more details), 2.5 Å
SCOP Domain Sequences for d1w93a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w93a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gdkisstivaqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkak rigfpvmikaseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevql ladqygtnislfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagt veylyshddgkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlyg mnphsaseidfefktqdatkkqrrpip
Timeline for d1w93a3: