![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries) Uniprot Q00955 13-566 |
![]() | Domain d1w93a2: 1w93 A:14-183 [114395] Other proteins in same PDB: d1w93a1, d1w93a3 |
PDB Entry: 1w93 (more details), 2.5 Å
SCOPe Domain Sequences for d1w93a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w93a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl
Timeline for d1w93a2: