Lineage for d1w93a2 (1w93 A:14-183)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120506Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2120507Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species)
  7. 2120508Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries)
    Uniprot Q00955 13-566
  8. 2120512Domain d1w93a2: 1w93 A:14-183 [114395]
    Other proteins in same PDB: d1w93a1, d1w93a3

Details for d1w93a2

PDB Entry: 1w93 (more details), 2.5 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae
PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1w93a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w93a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl

SCOPe Domain Coordinates for d1w93a2:

Click to download the PDB-style file with coordinates for d1w93a2.
(The format of our PDB-style files is described here.)

Timeline for d1w93a2: