SCOP 1.71: Domain d1w93a2: 1w93 A:14-183

Lineage for d1w93a2 (1w93 A:14-183)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (6 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Acetyl-CoA carboxylase, BC-N subdomain [117496] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117497] (2 PDB entries)

8. Domain d1w93a2: 1w93 A:14-183 [114395]
   Other proteins in same PDB: d1w93a1, d1w93a3

Details for d1w93a2

PDB Entry: 1w93, 2.5 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae

SCOP Domain Sequences for d1w93a2:

Sequence; same for both SEQRES and ATOM records:

>d1w93a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae)}
meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrsl

Timeline for d1w93a2:

• d1w93a2 is new in SCOP 1.71
  
• d1w93a2 appears in SCOP 1.73
  
• d1w93a2 appears in the current release, SCOPe 2.08