SCOPe 2.06: Domain d1w93a1: 1w93 A:451-566

Lineage for d1w93a1 (1w93 A:451-566)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Acetyl-CoA carboxylase, BC-C subdomain [117328] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117329] (2 PDB entries)
   Uniprot Q00955 13-566

8. Domain d1w93a1: 1w93 A:451-566 [114394]
   Other proteins in same PDB: d1w93a2, d1w93a3

Details for d1w93a1

PDB Entry: 1w93, 2.5 Å

PDB Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae

PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1w93a1:

Sequence, based on SEQRES records:

>d1w93a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvgnngnihsfsdsqfghif
afgenrqasrkhmvvalkelsirgdfrttveyliklletedfedntittgwlddli

Sequence, based on observed residues (ATOM records):

>d1w93a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvgnngnihsfsdsqfghif
afgenrqasrkhmvvalkelsirgtveyliklletedfedntittgwlddli

Timeline for d1w93a1:

• d1w93a1 first appeared in SCOP 1.71
  
• d1w93a1 appears in SCOPe 2.05
  
• d1w93a1 appears in SCOPe 2.07
  
• d1w93a1 appears in the current release, SCOPe 2.08