SCOP 1.71: Domain d1w92a_: 1w92 A:

Lineage for d1w92a_ (1w92 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (2 PDB entries)

8. Domain d1w92a_: 1w92 A: [114393]
   complexed with cmo, hem; mutant

Details for d1w92a_

PDB Entry: 1w92, 1.7 Å

PDB Description: the structure of carbomonoxy murine neuroglobin reveals a heme- sliding mechanism for affinity regulation

SCOP Domain Sequences for d1w92a_:

Sequence; same for both SEQRES and ATOM records:

>d1w92a_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus)}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgw

Timeline for d1w92a_:

• d1w92a_ is new in SCOP 1.71
  
• d1w92a_ appears in SCOP 1.73
  
• d1w92a_ appears in the current release, SCOPe 2.08