Lineage for d1w92a_ (1w92 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688341Protein Neuroglobin [100978] (2 species)
  7. 2688349Species Mouse (Mus musculus) [TaxId:10090] [109625] (38 PDB entries)
    Uniprot Q9ER97
  8. 2688366Domain d1w92a_: 1w92 A: [114393]
    complexed with cmo, hem

Details for d1w92a_

PDB Entry: 1w92 (more details), 1.7 Å

PDB Description: the structure of carbomonoxy murine neuroglobin reveals a heme- sliding mechanism for affinity regulation
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d1w92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w92a_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgw

SCOPe Domain Coordinates for d1w92a_:

Click to download the PDB-style file with coordinates for d1w92a_.
(The format of our PDB-style files is described here.)

Timeline for d1w92a_: