Lineage for d1w8xp_ (1w8x P:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1469367Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1469368Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1469369Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1469491Protein PRD1 capsid assembly [118379] (1 species)
  7. 1469492Species Bacteriophage PRD1 [TaxId:10658] [118380] (1 PDB entry)
  8. 1469507Domain d1w8xp_: 1w8x P: [114392]

Details for d1w8xp_

PDB Entry: 1w8x (more details), 4.2 Å

PDB Description: structural analysis of prd1
PDB Compounds: (P:) protein p16

SCOPe Domain Sequences for d1w8xp_:

Sequence, based on SEQRES records: (download)

>d1w8xp_ i.6.1.1 (P:) PRD1 capsid assembly {Bacteriophage PRD1 [TaxId: 10658]}
mdkkkllywvggglvliliwlwfrnrpaaqvasnwegppymtynqpqagsvtlpvagyts
psptlpnrnrscgcnpavsaamaqgadlaskltdsitsqlndyasslndylasqagv

Sequence, based on observed residues (ATOM records): (download)

>d1w8xp_ i.6.1.1 (P:) PRD1 capsid assembly {Bacteriophage PRD1 [TaxId: 10658]}
mdkkkllywvggglvliliwlwfrnrpaaqvasnwegppymtynqpqagsvtlpvadsit
sqlndyasslndylasqagv

SCOPe Domain Coordinates for d1w8xp_:

Click to download the PDB-style file with coordinates for d1w8xp_.
(The format of our PDB-style files is described here.)

Timeline for d1w8xp_: