Class i: Low resolution protein structures [58117] (24 folds) |
Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) |
Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
Protein PRD1 capsid assembly [118379] (1 species) |
Species Bacteriophage PRD1 [TaxId:10658] [118380] (1 PDB entry) |
Domain d1w8xl_: 1w8x L: [114389] |
PDB Entry: 1w8x (more details)
SCOP Domain Sequences for d1w8xl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8xl_ i.6.1.1 (L:) PRD1 capsid assembly {Bacteriophage PRD1} qltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgiv kgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakq gapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanv pqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqn gyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdiny lsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpk tvnqnarllmgyeyftsrt
Timeline for d1w8xl_: